Thiol Tripeptide (GSH)
$1,200.00
Research Compounds
LL-37
LL-37 is a synthetic 37-residue cationic peptide corresponding to the C-terminal domain of the human cathelicidin precursor hCAP-18. It adopts an amphipathic alpha-helix in membrane-like environments. For research use only. Not for human or veterinary use.
$25.00
Availability: In stock, and ready to ship
What Is LL-37?
LL-37 is a synthetic 37-residue cationic peptide corresponding to the C-terminal domain of the human cathelicidin precursor hCAP-18. It adopts an amphipathic alpha-helix in membrane-like environments.
Research Focus
LL-37 is used as a reference host-defense peptide in in vitro studies of peptide-lipid membrane interactions, antibacterial activity against reference strains, biofilm formation, and immune-cell receptor signaling.
Product Details
Sequence [LL-37, 37 aa]; MW approx. 4493 g/mol. Supplied as a lyophilized powder (5 mg per vial). Store at -20°C, protected from light.
For research use only. Not for human or veterinary use. This product is not a drug, food, dietary supplement, or cosmetic and is supplied for in vitro laboratory research by qualified professionals only.
LL-37. Sequence [LL-37, 37 aa]; MW approx. 4493 g/mol. Supplied as a lyophilized powder (5 mg per vial). Store at -20°C, protected from light.
Review the available specifications and supporting documentation for the product and batch you are ordering. Contact our team if you need help locating a particular document.
Review the shipping options and applicable terms during checkout. For order support, delivery questions, or information about a product issue, contact our team with your order details.
Products
Related Products
Long-Arg3 IGF-1 Analog
$150.00
Melanocortin Receptor Agonist
$45.00
AED Tripeptide Bioregulator
$25.00
FAQ
Frequently Asked Questions
Is LL-37 approved for human use?
No. LL-37 is supplied for in vitro laboratory research only. It is not a drug, food, supplement or cosmetic, and research findings do not establish its safety or effectiveness for human or veterinary use.
Is LL-37 a peptide?
Yes. LL-37 is a synthetic 37-residue cationic peptide matching the C-terminal domain of the human cathelicidin precursor hCAP-18.
What is LL-37 studied for?
It is used as a reference host-defense peptide in in vitro studies of peptide-membrane interactions, antibacterial activity against reference strains, biofilms and immune-cell receptor signaling. Findings should be interpreted within their experimental context.
Where can I find the purity and specifications?
Check the product information and available quality documentation for the relevant batch. Contact our team if you require a particular specification or record.
How can I obtain additional product information?
Contact our team with the product name and the information you need. Include any relevant batch or order details so we can direct your enquiry.